PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G37170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 970aa    MW: 105627 Da    PI: 5.2219
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G37170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.5e-41152229178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC+adl+ +++yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  OPUNC03G37170.1 152 ACQVEGCTADLTGVRDYHRRHKVCEMHAKATTAVVGNTVQRFCQQCSRFHPLQEFDEGKRSCRRRLAGHNRRRRKTRP 229
                      5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.3E-34145214IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394150227IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-38151231IPR004333Transcription factor, SBP-box
PfamPF031101.6E-30153226IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.71E-8752857IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.209.4E-8754861IPR020683Ankyrin repeat-containing domain
CDDcd002049.85E-9757857No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 970 aa     Download sequence    Send to blast
MEAARVGAQS RHLYGGGGLG EPDMDRRDKR LFGWDLNDWR WDSDHFVATP VPAAEASGLV  60
LNSSPSSSEE AGAAVVRNVN VRGDSDKRKR VVVIDDDDVE DDELVENGGG SLSLRIGGDA  120
VAHGAGVGGG ADEEDRNGKK IRVQGGSSSG PACQVEGCTA DLTGVRDYHR RHKVCEMHAK  180
ATTAVVGNTV QRFCQQCSRF HPLQEFDEGK RSCRRRLAGH NRRRRKTRPE VAVGGSAFTE  240
DKVSSYLLLG LLGVCANLNA DNAEHLRGQE LLSSLLRNLG AVAKSLDPKE LCKLLEACQS  300
MQDGSNAGTS ETANALVNTA VAEAAGPSNS KMPFVNGDQC GLASSSVVPV QSKSPTVATP  360
EPPPCKFKDF DLNDTCGGME GFEDGYEGSP TPAFKTTDSP NCPSWMHQDS TQSPPQTSGN  420
SDSTSAQSLS SSNGDAQCRT DKIVFKLFEK VPSDLPPVLR SQILGWLSSS PTDIESYIRP  480
GCIILTVYLR LVESAWKELS DNMSSYLDKL LNSSTGNFWA SGLVFVMVRH QIAFMHNGQL  540
MLDRPLANSA HHYCKILCVR PIAAPFSTKV NFRVEGLNLV SDSSRLICSF EGSCIFQEDT  600
DNIVDDAEHD DIEYLNFYCP LPGSRGRGFV EVEDGGFSNG FFPFIIAEQD ICSEVCELES  660
IFESSSHEQA DDDNARNQAL EFLNELGWLL HRANVISKQD KVPLASFNLW RFRNLGIFAM  720
EREWCAVTKV LLDFLFIGLV DIGSQSPEEV VLSENLLHAA VRMKSAPMVR FLLGYKPNES  780
LKGTAETFLF RPDAQGPSKF TPLHIAAATD DAEDVLDALT NDPGLVGINA WRNARDDAGF  840
TPEDYARQRG NDAYLNMVEK KINKHLGKGH VVLGVPSSMH PVITDGAKPG EVSLEIGMSV  900
PPAAPRCNAC SRQALMYPNS TVRTFLYRPA MLTVMGIAVI CVCVGLLLHT CPKVYAAPTF  960
RWELLERGPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31146226484squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0698470.0AK069847.1 Oryza sativa Japonica Group cDNA clone:J023034C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631511.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLA0A0E0KL590.0A0A0E0KL59_ORYPU; Uncharacterized protein
STRINGORGLA03G0367800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1